| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
| Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [52443] (7 PDB entries) |
| Domain d2j9gb2: 2j9g B:1-114 [147941] Other proteins in same PDB: d2j9ga1, d2j9ga3, d2j9gb1, d2j9gb3 automatically matched to d1dv2a2 complexed with adp, anp, mg, so4 |
PDB Entry: 2j9g (more details), 2.05 Å
SCOP Domain Sequences for d2j9gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9gb2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d2j9gb2: