SCOPe 2.04: Domain d2j9gb1: 2j9g B:331-447

Lineage for d2j9gb1 (2j9g B:331-447)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)

8. Domain d2j9gb1: 2j9g B:331-447 [147940]
   Other proteins in same PDB: d2j9ga2, d2j9ga3, d2j9gb2, d2j9gb3
   automated match to d1dv1b1
   complexed with adp, anp, mg, so4

Details for d2j9gb1

PDB Entry: 2j9g, 2.05 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with amppnp and adp

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2j9gb1:

Sequence; same for both SEQRES and ATOM records:

>d2j9gb1 b.84.2.1 (B:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

Timeline for d2j9gb1:

• d2j9gb1 first appeared in SCOP 1.75
  
• d2j9gb1 appears in SCOPe 2.03
  
• d2j9gb1 appears in SCOPe 2.05
  
• d2j9gb1 appears in the current release, SCOPe 2.08