Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) Heme-containing proteins |
Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
Protein automated matches [190363] (5 species) not a true protein |
Species Rhodocyclus gelatinosus [TaxId:28068] [187197] (1 PDB entry) |
Domain d2j9bb_: 2j9b B: [147936] automated match to d1jafa_ complexed with hem |
PDB Entry: 2j9b (more details), 1.5 Å
SCOPe Domain Sequences for d2j9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9bb_ a.24.3.2 (B:) automated matches {Rhodocyclus gelatinosus [TaxId: 28068]} qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack gchdkfkek
Timeline for d2j9bb_: