![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
![]() | Protein automated matches [190363] (5 species) not a true protein |
![]() | Species Rhodocyclus gelatinosus [TaxId:28068] [187197] (1 PDB entry) |
![]() | Domain d2j9ba_: 2j9b A: [147935] automated match to d1jafa_ complexed with hec |
PDB Entry: 2j9b (more details), 1.5 Å
SCOPe Domain Sequences for d2j9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ba_ a.24.3.2 (A:) automated matches {Rhodocyclus gelatinosus [TaxId: 28068]} qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack gchdkfk
Timeline for d2j9ba_: