![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
![]() | Protein automated matches [190384] (21 species) not a true protein |
![]() | Species Foot-and-mouth disease virus (strain a10-61) [TaxId:12112] [187901] (1 PDB entry) |
![]() | Domain d2j92b_: 2j92 B: [147934] Other proteins in same PDB: d2j92a1 automated match to d2j92a1 mutant |
PDB Entry: 2j92 (more details), 2.2 Å
SCOPe Domain Sequences for d2j92b_:
Sequence, based on SEQRES records: (download)
>d2j92b_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus (strain a10-61) [TaxId: 12112]} dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn gvgycscvsrsmlqkmkahv
>d2j92b_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus (strain a10-61) [TaxId: 12112]} dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd yrvfefelsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrlifsgeal tykdivmpglfaykaatragyaggavlakdgadtfivgthsaggngvgycscvsrsmlqk mkahv
Timeline for d2j92b_: