Lineage for d2j92b_ (2j92 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2058059Species Foot-and-mouth disease virus (strain a10-61) [TaxId:12112] [187901] (1 PDB entry)
  8. 2058060Domain d2j92b_: 2j92 B: [147934]
    Other proteins in same PDB: d2j92a1
    automated match to d2j92a1
    mutant

Details for d2j92b_

PDB Entry: 2j92 (more details), 2.2 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus-crystal packing mutant (k51q)
PDB Compounds: (B:) picornain 3c

SCOPe Domain Sequences for d2j92b_:

Sequence, based on SEQRES records: (download)

>d2j92b_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus (strain a10-61) [TaxId: 12112]}
dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkahv

Sequence, based on observed residues (ATOM records): (download)

>d2j92b_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus (strain a10-61) [TaxId: 12112]}
dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd
yrvfefelsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrlifsgeal
tykdivmpglfaykaatragyaggavlakdgadtfivgthsaggngvgycscvsrsmlqk
mkahv

SCOPe Domain Coordinates for d2j92b_:

Click to download the PDB-style file with coordinates for d2j92b_.
(The format of our PDB-style files is described here.)

Timeline for d2j92b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j92a1