SCOPe 2.06: Domain d2j92a1: 2j92 A:7-207

Lineage for d2j92a1 (2j92 A:7-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [159189] (2 PDB entries)
   Uniprot P49303 1657-1755! Uniprot P49303 1657-1857

8. Domain d2j92a1: 2j92 A:7-207 [147933]
   Other proteins in same PDB: d2j92b_
   mutant

Details for d2j92a1

PDB Entry: 2j92, 2.2 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus-crystal packing mutant (k51q)

PDB Compounds: (A:) picornain 3c

SCOPe Domain Sequences for d2j92a1:

Sequence; same for both SEQRES and ATOM records:

>d2j92a1 b.47.1.4 (A:7-207) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkahve

Timeline for d2j92a1:

• d2j92a1 first appeared in SCOP 1.75
  
• d2j92a1 appears in SCOPe 2.05
  
• d2j92a1 appears in SCOPe 2.07
  
• d2j92a1 appears in the current release, SCOPe 2.08