Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Foot-and-mouth disease virus [TaxId:12110] [159189] (2 PDB entries) Uniprot P49303 1657-1755! Uniprot P49303 1657-1857 |
Domain d2j92a1: 2j92 A:7-207 [147933] Other proteins in same PDB: d2j92b_ mutant |
PDB Entry: 2j92 (more details), 2.2 Å
SCOPe Domain Sequences for d2j92a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j92a1 b.47.1.4 (A:7-207) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus [TaxId: 12110]} dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn gvgycscvsrsmlqkmkahve
Timeline for d2j92a1: