Lineage for d2j92a1 (2j92 A:7-207)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803590Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 803595Protein 3C cysteine protease (picornain 3C) [50604] (4 species)
  7. 803596Species Foot-and-mouth disease virus FMDV [TaxId:12110] [159189] (2 PDB entries)
    Uniprot P49303 1657-1755! Uniprot P49303 1657-1857
  8. 803599Domain d2j92a1: 2j92 A:7-207 [147933]
    mutant

Details for d2j92a1

PDB Entry: 2j92 (more details), 2.2 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus-crystal packing mutant (k51q)
PDB Compounds: (A:) picornain 3c

SCOP Domain Sequences for d2j92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j92a1 b.47.1.4 (A:7-207) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]}
dlqkmvmgntkpvelildgktvaiccatgvfgtaylvprhlfaeqydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkahve

SCOP Domain Coordinates for d2j92a1:

Click to download the PDB-style file with coordinates for d2j92a1.
(The format of our PDB-style files is described here.)

Timeline for d2j92a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j92b1