| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
| Protein automated matches [190363] (5 species) not a true protein |
| Species Rubrivivax gelatinosus [TaxId:28068] [187196] (1 PDB entry) |
| Domain d2j8wb_: 2j8w B: [147932] automated match to d1jafa_ complexed with hec |
PDB Entry: 2j8w (more details), 1.29 Å
SCOPe Domain Sequences for d2j8wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8wb_ a.24.3.2 (B:) automated matches {Rubrivivax gelatinosus [TaxId: 28068]}
qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg
pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack
gchdkfkek
Timeline for d2j8wb_: