SCOPe 2.05: Domain d2j8wa_: 2j8w A:

Lineage for d2j8wa_ (2j8w A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (4 species)
   not a true protein

7. Species Rubrivivax gelatinosus [TaxId:28068] [187196] (1 PDB entry)

8. Domain d2j8wa_: 2j8w A: [147931]
   automated match to d1jafa_
   complexed with hem

Details for d2j8wa_

PDB Entry: 2j8w, 1.29 Å

PDB Description: the crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.3 a resolution and ph 8.0

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2j8wa_:

Sequence; same for both SEQRES and ATOM records:

>d2j8wa_ a.24.3.2 (A:) automated matches {Rubrivivax gelatinosus [TaxId: 28068]}
qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg
pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack
gchdkfkek

Timeline for d2j8wa_:

• d2j8wa_ first appeared in SCOP 1.75, called d2j8wa1
  
• d2j8wa_ appears in SCOPe 2.04
  
• d2j8wa_ appears in SCOPe 2.06
  
• d2j8wa_ appears in the current release, SCOPe 2.08