Lineage for d2j8wa_ (2j8w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699842Protein automated matches [190363] (5 species)
    not a true protein
  7. 2699885Species Rubrivivax gelatinosus [TaxId:28068] [187196] (1 PDB entry)
  8. 2699886Domain d2j8wa_: 2j8w A: [147931]
    automated match to d1jafa_
    complexed with hec

Details for d2j8wa_

PDB Entry: 2j8w (more details), 1.29 Å

PDB Description: the crystal structure of cytochrome c' from rubrivivax gelatinosus at 1.3 a resolution and ph 8.0
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2j8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8wa_ a.24.3.2 (A:) automated matches {Rubrivivax gelatinosus [TaxId: 28068]}
qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg
pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack
gchdkfkek

SCOPe Domain Coordinates for d2j8wa_:

Click to download the PDB-style file with coordinates for d2j8wa_.
(The format of our PDB-style files is described here.)

Timeline for d2j8wa_: