Lineage for d2j8uf2 (2j8u F:118-245)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109120Protein T-cell antigen receptor [49125] (6 species)
  7. 1109222Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 1109239Domain d2j8uf2: 2j8u F:118-245 [147923]
    Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub_, d2j8ue1, d2j8uf1, d2j8uh1, d2j8uh2, d2j8ui_, d2j8ul1, d2j8um1
    automatically matched to d1lp9f2
    mutant

Details for d2j8uf2

PDB Entry: 2j8u (more details), 2.88 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation.
PDB Compounds: (F:) ahiii tcr beta chain

SCOPe Domain Sequences for d2j8uf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8uf2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d2j8uf2:

Click to download the PDB-style file with coordinates for d2j8uf2.
(The format of our PDB-style files is described here.)

Timeline for d2j8uf2: