Lineage for d2j8uf2 (2j8u F:118-245)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786933Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 786948Domain d2j8uf2: 2j8u F:118-245 [147923]
    Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub1, d2j8ue1, d2j8uf1, d2j8uh1, d2j8uh2, d2j8ui1, d2j8ul1, d2j8um1
    automatically matched to d1lp9f2
    mutant

Details for d2j8uf2

PDB Entry: 2j8u (more details), 2.88 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation.
PDB Compounds: (F:) ahiii tcr beta chain

SCOP Domain Sequences for d2j8uf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8uf2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOP Domain Coordinates for d2j8uf2:

Click to download the PDB-style file with coordinates for d2j8uf2.
(The format of our PDB-style files is described here.)

Timeline for d2j8uf2: