![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries) |
![]() | Domain d2j8ue1: 2j8u E:0-117 [147920] Other proteins in same PDB: d2j8ua1, d2j8ua2, d2j8ub_, d2j8ue2, d2j8uf2, d2j8uh1, d2j8uh2, d2j8ui_, d2j8ul2, d2j8um2 automatically matched to d1lp9e1 mutant |
PDB Entry: 2j8u (more details), 2.88 Å
SCOPe Domain Sequences for d2j8ue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ue1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn
Timeline for d2j8ue1: