![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (3 proteins) Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor permutation of the common fold; strand 8 is antiparallel to the rest of the barrel |
![]() | Protein N-terminal domain of endolysin [89484] (1 species) |
![]() | Species Bacteriophage cp-1 [TaxId:10747] [89485] (6 PDB entries) |
![]() | Domain d2j8ga2: 2j8g A:2-190 [147916] Other proteins in same PDB: d2j8ga1 automatically matched to d1h09a2 complexed with ala, amv, fmt, lys, nag; mutant |
PDB Entry: 2j8g (more details), 1.69 Å
SCOP Domain Sequences for d2j8ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ga2 c.1.8.8 (A:2-190) N-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]} vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf arfggdvaeaereaqffldnvpmqvkylvldyqddpsgdaqantnaclrfmqmiadagyk piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf dknivlldd
Timeline for d2j8ga2: