Lineage for d2j8ga2 (2j8g A:2-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832108Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins)
    Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
    permutation of the common fold; strand 8 is antiparallel to the rest of the barrel
  6. 2832119Protein automated matches [254544] (2 species)
    not a true protein
  7. 2832120Species Bacteriophage cp-1 [TaxId:10747] [255251] (2 PDB entries)
  8. 2832121Domain d2j8ga2: 2j8g A:2-190 [147916]
    Other proteins in same PDB: d2j8ga1
    automated match to d1h09a2
    complexed with ala, dgl, fmt, lys; mutant

Details for d2j8ga2

PDB Entry: 2j8g (more details), 1.69 Å

PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (e94q mutant in complex with a tetrasaccharide- pentapeptide)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2j8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ga2 c.1.8.8 (A:2-190) automated matches {Bacteriophage cp-1 [TaxId: 10747]}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyqddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd

SCOPe Domain Coordinates for d2j8ga2:

Click to download the PDB-style file with coordinates for d2j8ga2.
(The format of our PDB-style files is described here.)

Timeline for d2j8ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j8ga1