![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins) Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor permutation of the common fold; strand 8 is antiparallel to the rest of the barrel |
![]() | Protein automated matches [254544] (2 species) not a true protein |
![]() | Species Bacteriophage cp-1 [TaxId:10747] [255251] (2 PDB entries) |
![]() | Domain d2j8ga2: 2j8g A:2-190 [147916] Other proteins in same PDB: d2j8ga1 automated match to d1h09a2 complexed with ala, dgl, fmt, lys; mutant |
PDB Entry: 2j8g (more details), 1.69 Å
SCOPe Domain Sequences for d2j8ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ga2 c.1.8.8 (A:2-190) automated matches {Bacteriophage cp-1 [TaxId: 10747]} vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf arfggdvaeaereaqffldnvpmqvkylvldyqddpsgdaqantnaclrfmqmiadagyk piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf dknivlldd
Timeline for d2j8ga2: