SCOP 1.75: Domain d2j8ga1: 2j8g A:191-339

Lineage for d2j8ga1 (2j8g A:191-339)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
   Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn

4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family)

5. Family b.109.1.1: Cell wall binding repeat [69361] (3 proteins)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein C-terminal domain of endolysin [89422] (1 species)

7. Species Bacteriophage cp-1 [TaxId:10747] [89423] (6 PDB entries)

8. Domain d2j8ga1: 2j8g A:191-339 [147915]
   Other proteins in same PDB: d2j8ga2
   automatically matched to d1h09a1
   complexed with ala, amv, fmt, lys, nag; mutant

Details for d2j8ga1

PDB Entry: 2j8g, 1.69 Å

PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (e94q mutant in complex with a tetrasaccharide- pentapeptide)

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d2j8ga1:

Sequence; same for both SEQRES and ATOM records:

>d2j8ga1 b.109.1.1 (A:191-339) C-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]}
eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek
wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg
kgwyfmntngeladnpsftkepdglitva

Timeline for d2j8ga1:

• d2j8ga1 is new in SCOP 1.75
  
• d2j8ga1 appears in SCOPe 2.01
  
• d2j8ga1 appears in the current release, SCOPe 2.08