![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.109: beta-hairpin stack [69359] (1 superfamily) Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn |
![]() | Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) ![]() |
![]() | Family b.109.1.1: Cell wall binding repeat [69361] (3 proteins) this is a repeat family; one repeat unit is 2bib A:415-315 found in domain |
![]() | Protein C-terminal domain of endolysin [89422] (1 species) |
![]() | Species Bacteriophage cp-1 [TaxId:10747] [89423] (6 PDB entries) |
![]() | Domain d2j8ga1: 2j8g A:191-339 [147915] Other proteins in same PDB: d2j8ga2 automatically matched to d1h09a1 complexed with ala, amv, fmt, lys, nag; mutant |
PDB Entry: 2j8g (more details), 1.69 Å
SCOP Domain Sequences for d2j8ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8ga1 b.109.1.1 (A:191-339) C-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]} eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg kgwyfmntngeladnpsftkepdglitva
Timeline for d2j8ga1: