SCOPe 2.08: Domain d2j8fa2: 2j8f A:2-190

Lineage for d2j8fa2 (2j8f A:2-190)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins)
   Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
   permutation of the common fold; strand 8 is antiparallel to the rest of the barrel

6. Protein automated matches [254544] (2 species)
   not a true protein

7. Species Bacteriophage cp-1 [TaxId:10747] [255251] (2 PDB entries)

8. Domain d2j8fa2: 2j8f A:2-190 [147914]
   Other proteins in same PDB: d2j8fa1
   automated match to d1h09a2
   complexed with ala, dgl, fmt; mutant

Details for d2j8fa2

PDB Entry: 2j8f, 1.84 Å

PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (e94q mutant in complex with a disaccharide- pentapeptide)

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2j8fa2:

Sequence; same for both SEQRES and ATOM records:

>d2j8fa2 c.1.8.8 (A:2-190) automated matches {Bacteriophage cp-1 [TaxId: 10747]}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyqddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd

Timeline for d2j8fa2:

• d2j8fa2 first appeared in SCOP 1.75
  
• d2j8fa2 appears in SCOPe 2.07