![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.109: beta-hairpin stack [69359] (1 superfamily) Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn |
![]() | Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) ![]() |
![]() | Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins) this is a repeat family; one repeat unit is 2bib A:415-315 found in domain |
![]() | Protein automated matches [190222] (3 species) not a true protein |
![]() | Species Bacteriophage cp-1 [TaxId:10747] [255252] (2 PDB entries) |
![]() | Domain d2j8fa1: 2j8f A:191-339 [147913] Other proteins in same PDB: d2j8fa2 automated match to d2j8ga1 complexed with ala, dgl, fmt; mutant |
PDB Entry: 2j8f (more details), 1.84 Å
SCOPe Domain Sequences for d2j8fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8fa1 b.109.1.1 (A:191-339) automated matches {Bacteriophage cp-1 [TaxId: 10747]} eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg kgwyfmntngeladnpsftkepdglitva
Timeline for d2j8fa1: