Lineage for d2j8ba_ (2j8b A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063231Protein automated matches [190308] (2 species)
    not a true protein
  7. 1063232Species Human (Homo sapiens) [TaxId:9606] [187126] (3 PDB entries)
  8. 1063233Domain d2j8ba_: 2j8b A: [147908]
    automated match to d1cdqa_

Details for d2j8ba_

PDB Entry: 2j8b (more details), 1.15 Å

PDB Description: high resolution structure of human cd59
PDB Compounds: (A:) cd59 glycoprotein

SCOPe Domain Sequences for d2j8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8ba_ g.7.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqlen

SCOPe Domain Coordinates for d2j8ba_:

Click to download the PDB-style file with coordinates for d2j8ba_.
(The format of our PDB-style files is described here.)

Timeline for d2j8ba_: