SCOPe 2.02: Domain d2j80b_: 2j80 B:

Lineage for d2j80b_ (2j80 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (3 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)

6. Protein automated matches [190413] (2 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [187288] (2 PDB entries)

8. Domain d2j80b_: 2j80 B: [147907]
   automated match to d1p0za_
   complexed with flc, gol, na, so4

Details for d2j80b_

PDB Entry: 2j80, 1.6 Å

PDB Description: structure of citrate-bound periplasmic domain of sensor histidine kinase cita

PDB Compounds: (B:) Sensor kinase citA

SCOPe Domain Sequences for d2j80b_:

Sequence; same for both SEQRES and ATOM records:

>d2j80b_ d.110.6.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
erlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasgq
rlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivsv
gyti

Timeline for d2j80b_:

• d2j80b_ first appeared in SCOP 1.75, called d2j80b1
  
• d2j80b_ appears in SCOPe 2.01
  
• d2j80b_ appears in SCOPe 2.03
  
• d2j80b_ appears in the current release, SCOPe 2.08