Lineage for d2j80b_ (2j80 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970928Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)
  6. 2970944Protein automated matches [190413] (2 species)
    not a true protein
  7. 2970947Species Klebsiella pneumoniae [TaxId:573] [187288] (2 PDB entries)
  8. 2970949Domain d2j80b_: 2j80 B: [147907]
    automated match to d1p0za_
    complexed with flc, gol, na, so4

Details for d2j80b_

PDB Entry: 2j80 (more details), 1.6 Å

PDB Description: structure of citrate-bound periplasmic domain of sensor histidine kinase cita
PDB Compounds: (B:) Sensor kinase citA

SCOPe Domain Sequences for d2j80b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j80b_ d.110.6.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
erlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasgq
rlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivsv
gyti

SCOPe Domain Coordinates for d2j80b_:

Click to download the PDB-style file with coordinates for d2j80b_.
(The format of our PDB-style files is described here.)

Timeline for d2j80b_: