Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (3 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins) |
Protein automated matches [190413] (2 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [187288] (2 PDB entries) |
Domain d2j80a_: 2j80 A: [147906] automated match to d1p0za_ complexed with flc, gol, na, so4 |
PDB Entry: 2j80 (more details), 1.6 Å
SCOPe Domain Sequences for d2j80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j80a_ d.110.6.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas gqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigiv svgytieql
Timeline for d2j80a_: