SCOP 1.75: Domain d2j80a1: 2j80 A:5-132

Lineage for d2j80a1 (2j80 A:5-132)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (3 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (2 proteins)

6. Protein Sensor kinase CitA [103192] (1 species)
   citrate-binding domain

7. Species Klebsiella pneumoniae [TaxId:573] [103193] (3 PDB entries)

8. Domain d2j80a1: 2j80 A:5-132 [147906]
   automatically matched to d1p0za_
   complexed with flc, gol, na, so4

Details for d2j80a1

PDB Entry: 2j80, 1.6 Å

PDB Description: structure of citrate-bound periplasmic domain of sensor histidine kinase cita

PDB Compounds: (A:) Sensor kinase citA

SCOP Domain Sequences for d2j80a1:

Sequence; same for both SEQRES and ATOM records:

>d2j80a1 d.110.6.1 (A:5-132) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]}
eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
vgytieql

Timeline for d2j80a1:

• d2j80a1 is new in SCOP 1.75
  
• d2j80a1 is called d2j80a_ in SCOPe 2.01
  
• d2j80a1 appears in the current release, SCOPe 2.08, called d2j80a_