Lineage for d2j74a_ (2j74 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2439915Species Bacillus licheniformis [TaxId:1402] [187025] (3 PDB entries)
  8. 2439919Domain d2j74a_: 2j74 A: [147901]
    automated match to d1ur0b_
    complexed with b2g, b4g, ca

Details for d2j74a_

PDB Entry: 2j74 (more details), 2.6 Å

PDB Description: structure of beta-1,4-galactanase
PDB Compounds: (A:) yvfo

SCOPe Domain Sequences for d2j74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j74a_ c.1.8.3 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpf

SCOPe Domain Coordinates for d2j74a_:

Click to download the PDB-style file with coordinates for d2j74a_.
(The format of our PDB-style files is described here.)

Timeline for d2j74a_: