SCOPe 2.07: Domain d2j72b_: 2j72 B:

Lineage for d2j72b_ (2j72 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [158937] (3 PDB entries)
   Uniprot O33840 19-102

8. Domain d2j72b_: 2j72 B: [147898]
   automated match to d2j71a1

Details for d2j72b_

PDB Entry: 2j72, 1.49 Å

PDB Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula

PDB Compounds: (B:) pullulanase

SCOPe Domain Sequences for d2j72b_:

Sequence; same for both SEQRES and ATOM records:

>d2j72b_ b.3.1.3 (B:) Pullulanase PulA {Thermotoga maritima [TaxId: 2336]}
ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

Timeline for d2j72b_:

• d2j72b_ first appeared in SCOP 1.75, called d2j72b1
  
• d2j72b_ appears in SCOPe 2.06
  
• d2j72b_ appears in the current release, SCOPe 2.08