Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) |
Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
Protein Pullulanase PulA [158933] (4 species) |
Species Thermotoga maritima [TaxId:2336] [158937] (3 PDB entries) Uniprot O33840 19-102 |
Domain d2j72b_: 2j72 B: [147898] automated match to d2j71a1 |
PDB Entry: 2j72 (more details), 1.49 Å
SCOPe Domain Sequences for d2j72b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j72b_ b.3.1.3 (B:) Pullulanase PulA {Thermotoga maritima [TaxId: 2336]} ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp
Timeline for d2j72b_: