SCOP 1.75: Domain d2j72b1: 2j72 B:6-107

Lineage for d2j72b1 (2j72 B:6-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [158937] (3 PDB entries)
   Uniprot O33840 19-102

8. Domain d2j72b1: 2j72 B:6-107 [147898]
   automatically matched to 2J71 A:5-106
   complexed with glc

Details for d2j72b1

PDB Entry: 2j72, 1.49 Å

PDB Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula

PDB Compounds: (B:) pullulanase

SCOP Domain Sequences for d2j72b1:

Sequence; same for both SEQRES and ATOM records:

>d2j72b1 b.3.1.3 (B:6-107) Pullulanase PulA {Thermotoga maritima [TaxId: 2336]}
tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

Timeline for d2j72b1:

• d2j72b1 is new in SCOP 1.75
  
• d2j72b1 is called d2j72b_ in SCOPe 2.01
  
• d2j72b1 appears in the current release, SCOPe 2.08, called d2j72b_