Lineage for d2j72a1 (2j72 A:6-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790484Family b.3.1.3: PUD-like [158932] (1 protein)
    Pfam PF03714; bacterial pullanase-associated domain
  6. 790485Protein Pullulanase PulA [158933] (4 species)
  7. 790498Species Thermotoga maritima [TaxId:2336] [158937] (3 PDB entries)
    Uniprot O33840 19-102
  8. 790501Domain d2j72a1: 2j72 A:6-107 [147897]
    automatically matched to 2J71 A:5-106
    complexed with glc

Details for d2j72a1

PDB Entry: 2j72 (more details), 1.49 Å

PDB Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
PDB Compounds: (A:) pullulanase

SCOP Domain Sequences for d2j72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j72a1 b.3.1.3 (A:6-107) Pullulanase PulA {Thermotoga maritima [TaxId: 2336]}
tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp

SCOP Domain Coordinates for d2j72a1:

Click to download the PDB-style file with coordinates for d2j72a1.
(The format of our PDB-style files is described here.)

Timeline for d2j72a1: