Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
Protein Hyaluronidase N-terminal domain [143619] (1 species) |
Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries) Uniprot Q8XL08 41-178 |
Domain d2j62b3: 2j62 B:40-178 [147894] Other proteins in same PDB: d2j62a1, d2j62a2, d2j62b1, d2j62b2 automatically matched to 2J62 A:40-178 complexed with cl, gsz |
PDB Entry: 2j62 (more details), 2.26 Å
SCOPe Domain Sequences for d2j62b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j62b3 d.92.2.3 (B:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]} qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf kqlvkesnipevnitdypt
Timeline for d2j62b3: