![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
![]() | Protein Hyaluronidase catalytic domain [141792] (1 species) |
![]() | Species Clostridium perfringens [TaxId:1502] [141793] (3 PDB entries) Uniprot Q8XL08 179-495 |
![]() | Domain d2j62b2: 2j62 B:179-495 [147893] Other proteins in same PDB: d2j62a1, d2j62a3, d2j62b1, d2j62b3 automatically matched to 2J62 A:179-495 complexed with cl, gsz |
PDB Entry: 2j62 (more details), 2.26 Å
SCOPe Domain Sequences for d2j62b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j62b2 c.1.8.10 (B:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf anhstrmdnktwaksgr
Timeline for d2j62b2: