Lineage for d2j62a3 (2j62 A:40-178)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 868202Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 868271Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 868286Protein Hyaluronidase N-terminal domain [143619] (1 species)
  7. 868287Species Clostridium perfringens [TaxId:1502] [143620] (3 PDB entries)
    Uniprot Q8XL08 41-178
  8. 868290Domain d2j62a3: 2j62 A:40-178 [147891]
    Other proteins in same PDB: d2j62a1, d2j62a2, d2j62b1, d2j62b2
    complexed with cl, gsz

Details for d2j62a3

PDB Entry: 2j62 (more details), 2.26 Å

PDB Description: structure of a bacterial o-glcnacase in complex with glcnacstatin
PDB Compounds: (A:) hyaluronidase

SCOP Domain Sequences for d2j62a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j62a3 d.92.2.3 (A:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

SCOP Domain Coordinates for d2j62a3:

Click to download the PDB-style file with coordinates for d2j62a3.
(The format of our PDB-style files is described here.)

Timeline for d2j62a3: