SCOPe 2.05: Domain d2j5yb_: 2j5y B:

Lineage for d2j5yb_ (2j5y B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
   Pfam PF01468; also includes FIVAR module, Pfam PF07554

6. Protein automated matches [190362] (1 species)
   not a true protein

7. Species Peptostreptococcus magnus [TaxId:1260] [187194] (2 PDB entries)

8. Domain d2j5yb_: 2j5y B: [147888]
   automated match to d1gaba_

Details for d2j5yb_

PDB Entry: 2j5y, 1.4 Å

PDB Description: crystal structure of the ga module from f.magna

PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOPe Domain Sequences for d2j5yb_:

Sequence; same for both SEQRES and ATOM records:

>d2j5yb_ a.8.1.2 (B:) automated matches {Peptostreptococcus magnus [TaxId: 1260]}
lvprgshmtidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkah
a

Timeline for d2j5yb_:

• d2j5yb_ first appeared in SCOP 1.75, called d2j5yb1
  
• d2j5yb_ appears in SCOPe 2.04
  
• d2j5yb_ is called d2j5yb2 in SCOPe 2.06
  
• d2j5yb_ appears in the current release, SCOPe 2.08, called d2j5yb2