Lineage for d2j5yb2 (2j5y B:1-53)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2697104Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 2697124Protein automated matches [190362] (1 species)
    not a true protein
  7. 2697125Species Peptostreptococcus magnus [TaxId:1260] [187194] (2 PDB entries)
  8. 2697127Domain d2j5yb2: 2j5y B:1-53 [147888]
    Other proteins in same PDB: d2j5ya3, d2j5yb3
    automated match to d1gaba_

Details for d2j5yb2

PDB Entry: 2j5y (more details), 1.4 Å

PDB Description: crystal structure of the ga module from f.magna
PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOPe Domain Sequences for d2j5yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j5yb2 a.8.1.2 (B:1-53) automated matches {Peptostreptococcus magnus [TaxId: 1260]}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOPe Domain Coordinates for d2j5yb2:

Click to download the PDB-style file with coordinates for d2j5yb2.
(The format of our PDB-style files is described here.)

Timeline for d2j5yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j5yb3