![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
![]() | Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins) Pfam PF01468; also includes FIVAR module, Pfam PF07554 |
![]() | Protein automated matches [190362] (1 species) not a true protein |
![]() | Species Peptostreptococcus magnus [TaxId:1260] [187194] (2 PDB entries) |
![]() | Domain d2j5ya2: 2j5y A:1-53 [147887] Other proteins in same PDB: d2j5ya3, d2j5yb3 automated match to d1gaba_ |
PDB Entry: 2j5y (more details), 1.4 Å
SCOPe Domain Sequences for d2j5ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5ya2 a.8.1.2 (A:1-53) automated matches {Peptostreptococcus magnus [TaxId: 1260]} tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha
Timeline for d2j5ya2: