Lineage for d2j4gb3 (2j4g B:4-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571780Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2571781Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 2571782Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 2571791Domain d2j4gb3: 2j4g B:4-126 [147881]
    Other proteins in same PDB: d2j4ga1, d2j4ga2, d2j4gb1, d2j4gb2
    automated match to d2j4ga3
    complexed with act, gol, nb1

Details for d2j4gb3

PDB Entry: 2j4g (more details), 2.25 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with n-butyl-thiazoline inhibitor
PDB Compounds: (B:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d2j4gb3:

Sequence, based on SEQRES records: (download)

>d2j4gb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Sequence, based on observed residues (ATOM records): (download)

>d2j4gb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsgmlisigekgdks
vrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOPe Domain Coordinates for d2j4gb3:

Click to download the PDB-style file with coordinates for d2j4gb3.
(The format of our PDB-style files is described here.)

Timeline for d2j4gb3: