![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
![]() | Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
![]() | Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
![]() | Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries) Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611 |
![]() | Domain d2j4gb1: 2j4g B:437-589 [147879] Other proteins in same PDB: d2j4ga2, d2j4ga3, d2j4gb2, d2j4gb3 automated match to d2j4ga1 complexed with act, gol, nb1 |
PDB Entry: 2j4g (more details), 2.25 Å
SCOPe Domain Sequences for d2j4gb1:
Sequence, based on SEQRES records: (download)
>d2j4gb1 a.246.1.1 (B:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt atrvikplidrtfatvvkffnqkfnahldattd
>d2j4gb1 a.246.1.1 (B:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} reesmdiqpaaerflkafgknydkadfetlqytfermkesadillmntenkpliveitpw vhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvktat rvikplidrtfatvvkffnqkfnahldattd
Timeline for d2j4gb1: