Lineage for d2j4be_ (2j4b E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617544Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
    multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon
  4. 2617545Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) (S)
    automatically mapped to Pfam PF04494
  5. 2617546Family d.379.1.1: Taf5 N-terminal domain-like [160898] (2 proteins)
    Pfam PF04494
  6. 2617561Protein automated matches [190727] (1 species)
    not a true protein
  7. 2617562Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [187892] (1 PDB entry)
  8. 2617566Domain d2j4be_: 2j4b E: [147875]
    Other proteins in same PDB: d2j4ba1
    automated match to d2j4ba1

Details for d2j4be_

PDB Entry: 2j4b (more details), 2.5 Å

PDB Description: crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
PDB Compounds: (E:) transcription initiation factor tfiid subunit 72/90-100 kda

SCOPe Domain Sequences for d2j4be_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4be_ d.379.1.1 (E:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
qmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdhy
nkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilkil
nqhldikvyv

SCOPe Domain Coordinates for d2j4be_:

Click to download the PDB-style file with coordinates for d2j4be_.
(The format of our PDB-style files is described here.)

Timeline for d2j4be_: