![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily) multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon |
![]() | Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) ![]() automatically mapped to Pfam PF04494 |
![]() | Family d.379.1.1: Taf5 N-terminal domain-like [160898] (2 proteins) Pfam PF04494 |
![]() | Protein automated matches [190727] (1 species) not a true protein |
![]() | Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [187892] (1 PDB entry) |
![]() | Domain d2j4be_: 2j4b E: [147875] Other proteins in same PDB: d2j4ba1 automated match to d2j4ba1 |
PDB Entry: 2j4b (more details), 2.5 Å
SCOPe Domain Sequences for d2j4be_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4be_ d.379.1.1 (E:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} qmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdhy nkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilkil nqhldikvyv
Timeline for d2j4be_:
![]() Domains from other chains: (mouse over for more information) d2j4ba1, d2j4bb_, d2j4bc_, d2j4bd_ |