Lineage for d2j49a1 (2j49 A:149-282)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883121Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
    multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon
  4. 883122Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) (S)
  5. 883123Family d.379.1.1: Taf5 N-terminal domain-like [160898] (1 protein)
    Pfam PF04494
  6. 883124Protein TAF5 subunit of TFIID [160899] (3 species)
  7. 883140Species Saccharomyces cerevisiae [TaxId:4932] [160901] (1 PDB entry)
    Uniprot P38129 149-282
  8. 883141Domain d2j49a1: 2j49 A:149-282 [147870]

Details for d2j49a1

PDB Entry: 2j49 (more details), 2.3 Å

PDB Description: crystal structure of yeast taf5 n-terminal domain
PDB Compounds: (A:) Transcription initiation factor TFIID subunit 5

SCOP Domain Sequences for d2j49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j49a1 d.379.1.1 (A:149-282) TAF5 subunit of TFIID {Saccharomyces cerevisiae [TaxId: 4932]}
penyiraysmlknwvdssleiykpelsyimypifiylflnlvaknpvyarrffdrfspdf
kdfhgseinrlfsvnsidhikenevasafqshkyritmskttlnlllyflnenesiggsl
iisvinqhldpniv

SCOP Domain Coordinates for d2j49a1:

Click to download the PDB-style file with coordinates for d2j49a1.
(The format of our PDB-style files is described here.)

Timeline for d2j49a1: