![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) ![]() |
![]() | Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
![]() | Protein Pullulanase PulA [158933] (4 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [158935] (1 PDB entry) Uniprot Q97SQ7 135-237! Uniprot Q97SQ7 238-353 |
![]() | Domain d2j44a1: 2j44 A:110-223 [147868] 2nd PUD complexed with glc, zn |
PDB Entry: 2j44 (more details), 2.1 Å
SCOP Domain Sequences for d2j44a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j44a1 b.3.1.3 (A:110-223) Pullulanase PulA {Streptococcus pneumoniae [TaxId: 1313]} yepqpagtvrvnyyrtdgnydkkslwywgdvknpssaqwpdgtdftatgkygryidipln eaarefgfllldeskgdvkirkenykftdlknhsqiflkdddesiytnpyyvhd
Timeline for d2j44a1: