Lineage for d2j44a1 (2j44 A:110-223)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790484Family b.3.1.3: PUD-like [158932] (1 protein)
    Pfam PF03714; bacterial pullanase-associated domain
  6. 790485Protein Pullulanase PulA [158933] (4 species)
  7. 790490Species Streptococcus pneumoniae [TaxId:1313] [158935] (1 PDB entry)
    Uniprot Q97SQ7 135-237! Uniprot Q97SQ7 238-353
  8. 790491Domain d2j44a1: 2j44 A:110-223 [147868]
    2nd PUD
    complexed with glc, zn

Details for d2j44a1

PDB Entry: 2j44 (more details), 2.1 Å

PDB Description: alpha-glucan binding by a streptococcal virulence factor
PDB Compounds: (A:) alkaline amylopullulanase

SCOP Domain Sequences for d2j44a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j44a1 b.3.1.3 (A:110-223) Pullulanase PulA {Streptococcus pneumoniae [TaxId: 1313]}
yepqpagtvrvnyyrtdgnydkkslwywgdvknpssaqwpdgtdftatgkygryidipln
eaarefgfllldeskgdvkirkenykftdlknhsqiflkdddesiytnpyyvhd

SCOP Domain Coordinates for d2j44a1:

Click to download the PDB-style file with coordinates for d2j44a1.
(The format of our PDB-style files is described here.)

Timeline for d2j44a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j44a2