Lineage for d2j44a1 (2j44 A:110-223)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) 
Family b.3.1.3: PUD-like [158932] (1 protein)
Pfam PF03714; bacterial pullanase-associated domainProtein Pullulanase PulA [158933] (4 species) 
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [158935] (1 PDB entry)
Uniprot Q97SQ7 135-237! Uniprot Q97SQ7 238-353
Domain d2j44a1: 2j44 A:110-223 [147868]
2nd PUD
complexed with zn
Details for d2j44a1
PDB Entry: 2j44 (more details), 2.1 Å
PDB Description: alpha-glucan binding by a streptococcal virulence factor
PDB Compounds: (A:) alkaline amylopullulanaseSCOPe Domain Sequences for d2j44a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j44a1 b.3.1.3 (A:110-223) Pullulanase PulA {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
yepqpagtvrvnyyrtdgnydkkslwywgdvknpssaqwpdgtdftatgkygryidipln
eaarefgfllldeskgdvkirkenykftdlknhsqiflkdddesiytnpyyvhd
SCOPe Domain Coordinates for d2j44a1:
Click to download the PDB-style file with coordinates for d2j44a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j44a1:
- d2j44a1 first appeared in SCOP 1.75
- d2j44a1 appears in SCOPe 2.07
View in 3D
