Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) |
Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
Protein Pullulanase PulA [158933] (4 species) |
Species Streptococcus pyogenes [TaxId:1314] [158936] (1 PDB entry) Uniprot Q1JEU6 105-211! Uniprot Q1JEU6 212-323 |
Domain d2j43a1: 2j43 A:5-111 [147864] 1st PUD |
PDB Entry: 2j43 (more details), 1.6 Å
SCOP Domain Sequences for d2j43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j43a1 b.3.1.3 (A:5-111) Pullulanase PulA {Streptococcus pyogenes [TaxId: 1314]} ashhlrmhfktlpageslgslglwvwgdvdqpskdwpngaitmtkakkddygyyldvpla akhrqqvsylinnkagenlskdqhislltpkmnevwidenyhahayr
Timeline for d2j43a1: