SCOP 1.75: Domain d2j43a1: 2j43 A:5-111

Lineage for d2j43a1 (2j43 A:5-111)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Streptococcus pyogenes [TaxId:1314] [158936] (1 PDB entry)
   Uniprot Q1JEU6 105-211! Uniprot Q1JEU6 212-323

8. Domain d2j43a1: 2j43 A:5-111 [147864]
   1st PUD

Details for d2j43a1

PDB Entry: 2j43, 1.6 Å

PDB Description: alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors

PDB Compounds: (A:) spydx

SCOP Domain Sequences for d2j43a1:

Sequence; same for both SEQRES and ATOM records:

>d2j43a1 b.3.1.3 (A:5-111) Pullulanase PulA {Streptococcus pyogenes [TaxId: 1314]}
ashhlrmhfktlpageslgslglwvwgdvdqpskdwpngaitmtkakkddygyyldvpla
akhrqqvsylinnkagenlskdqhislltpkmnevwidenyhahayr

Timeline for d2j43a1:

• d2j43a1 is new in SCOP 1.75
  
• d2j43a1 appears in SCOPe 2.01
  
• d2j43a1 appears in the current release, SCOPe 2.08