Lineage for d2j43a1 (2j43 A:5-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768717Family b.3.1.3: PUD-like [158932] (1 protein)
    Pfam PF03714; bacterial pullanase-associated domain
  6. 2768718Protein Pullulanase PulA [158933] (4 species)
  7. 2768726Species Streptococcus pyogenes [TaxId:1314] [158936] (1 PDB entry)
    Uniprot Q1JEU6 105-211! Uniprot Q1JEU6 212-323
  8. 2768727Domain d2j43a1: 2j43 A:5-111 [147864]
    1st PUD

Details for d2j43a1

PDB Entry: 2j43 (more details), 1.6 Å

PDB Description: alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors
PDB Compounds: (A:) spydx

SCOPe Domain Sequences for d2j43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j43a1 b.3.1.3 (A:5-111) Pullulanase PulA {Streptococcus pyogenes [TaxId: 1314]}
ashhlrmhfktlpageslgslglwvwgdvdqpskdwpngaitmtkakkddygyyldvpla
akhrqqvsylinnkagenlskdqhislltpkmnevwidenyhahayr

SCOPe Domain Coordinates for d2j43a1:

Click to download the PDB-style file with coordinates for d2j43a1.
(The format of our PDB-style files is described here.)

Timeline for d2j43a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j43a2