Lineage for d2j3sb2 (2j3s B:2136-2236)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975760Fold j.131: Filamin fragments [267594] (1 superfamily)
  4. 1975761Superfamily j.131.1: Filamin fragments [267606] (1 family) (S)
  5. 1975762Family j.131.1.1: Filamin fragments [267632] (1 protein)
  6. 1975763Protein Filamin fragments [267688] (1 species)
  7. 1975764Species Homo sapiens [TaxId:9606] [268007] (1 PDB entry)
  8. 1975765Domain d2j3sb2: 2j3s B:2136-2236 [147863]
    Other proteins in same PDB: d2j3sa1, d2j3sa2, d2j3sa3, d2j3sb1, d2j3sb3
    complexed with br, dio, gol

Details for d2j3sb2

PDB Entry: 2j3s (more details), 2.5 Å

PDB Description: crystal structure of the human filamin a ig domains 19 to 21
PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d2j3sb2:

Sequence, based on SEQRES records: (download)

>d2j3sb2 j.131.1.1 (B:2136-2236) Filamin fragments {Homo sapiens [TaxId: 9606]}
gegrvkesitrrrrapsvanvgshcdlslkipeisiqdmtaqvtspsgktheaeivegen
htycirfvpaemgthtvsvkykgqhvpgspfqftvgplgeg

Sequence, based on observed residues (ATOM records): (download)

>d2j3sb2 j.131.1.1 (B:2136-2236) Filamin fragments {Homo sapiens [TaxId: 9606]}
gegrvkesitrrrrapsvanvghcdirfvpaemgthtvftvgpg

SCOPe Domain Coordinates for d2j3sb2:

Click to download the PDB-style file with coordinates for d2j3sb2.
(The format of our PDB-style files is described here.)

Timeline for d2j3sb2: