SCOPe 2.08: Domain d2j3sa2: 2j3s A:2136-2236

Lineage for d2j3sa2 (2j3s A:2136-2236)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries)

8. Domain d2j3sa2: 2j3s A:2136-2236 [147861]
   Other proteins in same PDB: d2j3sa4, d2j3sb2, d2j3sb4
   automated match to d2j3sa2
   complexed with br, dio, gol

Details for d2j3sa2

PDB Entry: 2j3s, 2.5 Å

PDB Description: crystal structure of the human filamin a ig domains 19 to 21

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2j3sa2:

Sequence, based on SEQRES records:

>d2j3sa2 b.1.18.0 (A:2136-2236) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gegrvkesitrrrrapsvanvgshcdlslkipeisiqdmtaqvtspsgktheaeivegen
htycirfvpaemgthtvsvkykgqhvpgspfqftvgplgeg

Sequence, based on observed residues (ATOM records):

>d2j3sa2 b.1.18.0 (A:2136-2236) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gegrvkesitrrrrapsvanvgshcdliqdmtaqvtspsgktheaeiycirfvpaemgth
tvsvkykgqhvpgspfqftvgplgeg

Timeline for d2j3sa2:

• d2j3sa2 first appeared in SCOP 1.75
  
• d2j3sa2 appears in SCOPe 2.07