SCOPe 2.01: Domain d2j3sa1: 2j3s A:2237-2326

Lineage for d2j3sa1 (2j3s A:2237-2326)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin b [141025] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141026] (11 PDB entries)
   Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192

8. Domain d2j3sa1: 2j3s A:2237-2326 [147860]
   automatically matched to d2di8a1
   complexed with br, dio, gol

Details for d2j3sa1

PDB Entry: 2j3s, 2.5 Å

PDB Description: crystal structure of the human filamin a ig domains 19 to 21

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2j3sa1:

Sequence; same for both SEQRES and ATOM records:

>d2j3sa1 b.1.18.10 (A:2237-2326) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgva
yvvqepgdyevsvkfneehipdspfvvpva

Timeline for d2j3sa1:

• d2j3sa1 first appeared in SCOP 1.75
  
• d2j3sa1 appears in SCOPe 2.02
  
• d2j3sa1 appears in the current release, SCOPe 2.08