Lineage for d2j2jf_ (2j2j F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777097Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2777098Protein automated matches [190378] (9 species)
    not a true protein
  7. 2777099Species Canine adenovirus 2 [TaxId:10514] [187225] (1 PDB entry)
  8. 2777105Domain d2j2jf_: 2j2j F: [147857]
    automated match to d1p69a_

Details for d2j2jf_

PDB Entry: 2j2j (more details), 1.5 Å

PDB Description: canine adenovirus fibre head at 1.5 a resolution
PDB Compounds: (F:) fiber protein

SCOPe Domain Sequences for d2j2jf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2jf_ b.21.1.0 (F:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

SCOPe Domain Coordinates for d2j2jf_:

Click to download the PDB-style file with coordinates for d2j2jf_.
(The format of our PDB-style files is described here.)

Timeline for d2j2jf_: