| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
| Protein automated matches [190378] (9 species) not a true protein |
| Species Canine adenovirus 2 [TaxId:10514] [187225] (1 PDB entry) |
| Domain d2j2je_: 2j2j E: [147856] automated match to d1p69a_ |
PDB Entry: 2j2j (more details), 1.5 Å
SCOPe Domain Sequences for d2j2je_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2je_ b.21.1.0 (E:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq
Timeline for d2j2je_: