Lineage for d2j2jd1 (2j2j D:361-542)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793517Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 793518Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) (S)
  5. 793519Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 793520Protein Adenovirus fiber protein "knob" domain [49837] (7 species)
  7. 793521Species Canine adenovirus 2 [TaxId:10514] [158981] (2 PDB entries)
    Uniprot Q65914 361-542
  8. 793525Domain d2j2jd1: 2j2j D:361-542 [147855]
    automatically matched to 2J1K C:361-542

Details for d2j2jd1

PDB Entry: 2j2j (more details), 1.5 Å

PDB Description: canine adenovirus fibre head at 1.5 a resolution
PDB Compounds: (D:) fiber protein

SCOP Domain Sequences for d2j2jd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2jd1 b.21.1.1 (D:361-542) Adenovirus fiber protein "knob" domain {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

SCOP Domain Coordinates for d2j2jd1:

Click to download the PDB-style file with coordinates for d2j2jd1.
(The format of our PDB-style files is described here.)

Timeline for d2j2jd1: