![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
![]() | Protein automated matches [190378] (9 species) not a true protein |
![]() | Species Canine adenovirus 2 [TaxId:10514] [187225] (1 PDB entry) |
![]() | Domain d2j2jd_: 2j2j D: [147855] automated match to d1p69a_ |
PDB Entry: 2j2j (more details), 1.5 Å
SCOPe Domain Sequences for d2j2jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2jd_ b.21.1.0 (D:) automated matches {Canine adenovirus 2 [TaxId: 10514]} apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge nq
Timeline for d2j2jd_: